2WT7
Crystal structure of the bzip heterodimeric complex mafb:cfos bound to dna
PDB DOI: 10.2210/pdb2wt7/pdb
Classification: TRANSCRIPTION Organism(s): Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-09-11 Deposition Author(s): Holton, S. , Pogenberg, V. , Wilmanns, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.3 Å
Crystal structure of the bzip heterodimeric complex mafb:cfos bound to dna
Holton, S. , Pogenberg, V. , Wilmanns, M.
Primary Citation of Related Structures: 2WT7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTO-ONCOGENE PROTEIN C-FOS | A | 63 | Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAH |
| TRANSCRIPTION FACTOR MAFB | B | 90 | Lucilia Cuprina , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKSEKLAN |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2009-09-11 Deposition Author(s): Holton, S. , Pogenberg, V. , Wilmanns, M.