Hiv-1 protease inhibitors containing a tertiary alcohol in the transition-state mimic with improved cell-based antiviral activity
PDB DOI: 10.2210/pdb2wl0/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus Type 1 (Z2/Cdc-Z34 Isolate)
Deposited: 2009-06-19 Deposition Author(s): Axelsson, L. , Ekegren, J.K. , Hallberg, A. , Kihlstrom, J. , Larhed, M. , Mahalingam, A.K. , Samuelsson, B. , Unge, T. , Wallberg, H. , Wannberg, J.
Hiv-1 protease inhibitors containing a tertiary alcohol in the transition-state mimic with improved cell-based antiviral activity
Axelsson, L. , Ekegren, J.K. , Hallberg, A. , Kihlstrom, J. , Larhed, M. , Mahalingam, A.K. , Samuelsson, B. , Unge, T. , Wallberg, H. , Wannberg, J.
Primary Citation of Related Structures: 2WL0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEASE | A | 99 | Human Immunodeficiency Virus Type 1 (Z2/Cdc-Z34 Isolate) | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
| PROTEASE | B | 99 | Human Immunodeficiency Virus Type 1 (Z2/Cdc-Z34 Isolate) | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2009-06-19 Deposition Author(s): Axelsson, L. , Ekegren, J.K. , Hallberg, A. , Kihlstrom, J. , Larhed, M. , Mahalingam, A.K. , Samuelsson, B. , Unge, T. , Wallberg, H. , Wannberg, J.