Atomic resolution (0.94 a) structure of purified thaumatin i grown in sodium l-tartrate at 22c
PDB DOI: 10.2210/pdb2vhk/pdb
Classification: PLANT PROTEIN Organism(s): Thaumatococcus Daniellii
Deposited: 2007-11-21 Deposition Author(s): Asherie, N. , Ginsberg, C. , Jakoncic, J.
Atomic resolution (0.94 a) structure of purified thaumatin i grown in sodium l-tartrate at 22c
Asherie, N. , Ginsberg, C. , Jakoncic, J.
Primary Citation of Related Structures: 2VHK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| THAUMATIN-I | A | 206 | Thaumatococcus Daniellii | ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPT |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-11-21 Deposition Author(s): Asherie, N. , Ginsberg, C. , Jakoncic, J.