Crystal structure analysis of a mutant escherichia coli thioredoxin in which lysine 36 is replaced by glutamic acid
PDB DOI: 10.2210/pdb2tir/pdb
Classification: ELECTRON TRANSPORT Organism(s): Escherichia Coli
Deposited: 1993-01-10 Deposition Author(s): Eklund, H. , Fuchs, J.A. , Gleason, F.K. , Nikkola, M.
Crystal structure analysis of a mutant escherichia coli thioredoxin in which lysine 36 is replaced by glutamic acid
Eklund, H. , Fuchs, J.A. , Gleason, F.K. , Nikkola, M.
Primary Citation of Related Structures: 2TIR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| THIOREDOXIN | A | 108 | Escherichia Coli | SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCEMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA |
Method: X-RAY DIFFRACTION
Deposited Date: 1993-01-10 Deposition Author(s): Eklund, H. , Fuchs, J.A. , Gleason, F.K. , Nikkola, M.