Solution structures of the dna-binding domain (zf11) of immune-related zinc-finger protein zfat
PDB DOI: 10.2210/pdb2ruz/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2015-01-26 Deposition Author(s): Kigawa, T. , Tochio, N. , Umehara, T. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structures of the dna-binding domain (zf11) of immune-related zinc-finger protein zfat
Kigawa, T. , Tochio, N. , Umehara, T. , Yokoyama, S.
Primary Citation of Related Structures: 2RUZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger protein ZFAT | A | 38 | Homo Sapiens | GSSGSSGILLKCPTDGCDYSTPDKYKLQAHLKVHTALD |
Method: SOLUTION NMR
Deposited Date: 2015-01-26 Deposition Author(s): Kigawa, T. , Tochio, N. , Umehara, T. , Yokoyama, S.