2RU0
Solution structure of actinomycesin
PDB DOI: 10.2210/pdb2ru0/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Actinomyces Sp. Oral Taxon 171
Deposited: 2013-10-17 Deposition Author(s): Gao, B. , Ohki, S. , Umetsu, Y. , Zhu, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of actinomycesin
Gao, B. , Ohki, S. , Umetsu, Y. , Zhu, S.
Primary Citation of Related Structures: 2RU0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Arthropod defensin | A | 36 | Actinomyces Sp. Oral Taxon 171 | GFGCPWNAYECDRHCVSKGYTGGNCRGKIRQTCHCY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2013-10-17 Deposition Author(s): Gao, B. , Ohki, S. , Umetsu, Y. , Zhu, S.