Structure of sugar modified epidermal growth factor-like repeat 12 of mouse notch-1 receptor
PDB DOI: 10.2210/pdb2rqz/pdb
Classification: RECEPTOR Organism(s): N.A.
Deposited: 2010-02-26 Deposition Author(s): Fujitani, N. , Hosoguchi, K. , Nishimura, S. , Shimizu, K.
Structure of sugar modified epidermal growth factor-like repeat 12 of mouse notch-1 receptor
Fujitani, N. , Hosoguchi, K. , Nishimura, S. , Shimizu, K.
Primary Citation of Related Structures: 2RQZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Neurogenic locus notch homolog protein 1 | A | 38 | N.A. | DVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEI |
Method: SOLUTION NMR
Deposited Date: 2010-02-26 Deposition Author(s): Fujitani, N. , Hosoguchi, K. , Nishimura, S. , Shimizu, K.