PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

2RPQ

Solution structure of a sumo-interacting motif of mbd1-containing chromatin-associated factor 1 bound to sumo-3

PDB DOI: 10.2210/pdb2rpq/pdb

Classification: TRANSCRIPTION
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2008-07-07
Deposition Author(s): Ariyoshi, M. , Baba, D. , Ikegami, T. , Ikeguchi, M. , Saitoh, H. , Sekiyama, N. , Shirakawa, M. , Tochio, H. , Uchimura, Y. , Yamane, T.

Experimental Data Snapshot

Method: SOLUTION NMR
Resolution: N.A.

Literature

Solution structure of a sumo-interacting motif of mbd1-containing chromatin-associated factor 1 bound to sumo-3

Ariyoshi, M. , Baba, D. , Ikegami, T. , Ikeguchi, M. , Saitoh, H. , Sekiyama, N. , Shirakawa, M. , Tochio, H. , Uchimura, Y. , Yamane, T.

Primary Citation of Related Structures: 2RPQ


Proteins
Molecule Chains Sequence Length Organism Sequence
Small ubiquitin-related modifier 2 A 93 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Activating transcription factor 7-interacting protein 1 B 49 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSPEFKTIDASVSKKAADSTSQCGKATGSDSSGVIDLTMDDEESGASQD
Experimental Data

Method: SOLUTION NMR

Deposited Date: 2008-07-07
Deposition Author(s): Ariyoshi, M. , Baba, D. , Ikegami, T. , Ikeguchi, M. , Saitoh, H. , Sekiyama, N. , Shirakawa, M. , Tochio, H. , Uchimura, Y. , Yamane, T.