Structure of the c-terminal pid domain of fe65l1 complexed with the cytoplasmic tail of app reveals a novel peptide binding mode
PDB DOI: 10.2210/pdb2roz/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2008-04-25 Deposition Author(s): Harada, T. , Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S.
Structure of the c-terminal pid domain of fe65l1 complexed with the cytoplasmic tail of app reveals a novel peptide binding mode
Harada, T. , Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S.
Primary Citation of Related Structures: 2ROZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
peptide from Amyloid beta A4 protein | A | 32 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DAAVTPEERHLSKMQQNGYENPTYKFFEQMQN |
Amyloid beta A4 precursor protein-binding family B member 2 | B | 136 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSSGSSGPTPKTELVQKFRVQYLGMLPVDRPVGMDTLNSAIENLMTSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAANVSEAVQAACSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2008-04-25 Deposition Author(s): Harada, T. , Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tochio, N. , Watanabe, S. , Yokoyama, S.