Structural basis of pxxdy motif recognition in sh3 binding
PDB DOI: 10.2210/pdb2rol/pdb
Classification: SPLICING/SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2008-04-02 Deposition Author(s): Aitio, O. , Hellman, M. , Kesti, T. , Kleino, I. , Paakkonen, K. , Permi, P. , Saksela, K. , Samuilova, O. , Tossavainen, H.
Structural basis of pxxdy motif recognition in sh3 binding
Aitio, O. , Hellman, M. , Kesti, T. , Kleino, I. , Paakkonen, K. , Permi, P. , Saksela, K. , Samuilova, O. , Tossavainen, H.
Primary Citation of Related Structures: 2ROL
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Epidermal growth factor receptor kinase substrate 8-like protein 1 | A | 64 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSMGTAGKWVLCNYDFQARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPG |
12-meric peptide from T-cell surface glycoprotein CD3 epsilon chain | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PPVPNPDYEPIR |
Method: SOLUTION NMR
Deposited Date: 2008-04-02 Deposition Author(s): Aitio, O. , Hellman, M. , Kesti, T. , Kleino, I. , Paakkonen, K. , Permi, P. , Saksela, K. , Samuilova, O. , Tossavainen, H.