Structural basis of pxxdy motif recognition in sh3 binding
PDB DOI: 10.2210/pdb2rol/pdb
Classification: SPLICING/SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2008-04-02 Deposition Author(s): Aitio, O. , Hellman, M. , Kesti, T. , Kleino, I. , Paakkonen, K. , Permi, P. , Saksela, K. , Samuilova, O. , Tossavainen, H.
Method: SOLUTION NMR Resolution: N.A.
Structural basis of pxxdy motif recognition in sh3 binding
Aitio, O. , Hellman, M. , Kesti, T. , Kleino, I. , Paakkonen, K. , Permi, P. , Saksela, K. , Samuilova, O. , Tossavainen, H.
Primary Citation of Related Structures: 2ROL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Epidermal growth factor receptor kinase substrate 8-like protein 1 | A | 64 | Homo Sapiens , Synthetic Construct | GSMGTAGKWVLCNYDFQARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPG |
| 12-meric peptide from T-cell surface glycoprotein CD3 epsilon chain | B | 12 | Homo Sapiens , Synthetic Construct | PPVPNPDYEPIR |
Method: SOLUTION NMR
Deposited Date: 2008-04-02 Deposition Author(s): Aitio, O. , Hellman, M. , Kesti, T. , Kleino, I. , Paakkonen, K. , Permi, P. , Saksela, K. , Samuilova, O. , Tossavainen, H.