Rdc-refined solution structure of the n-terminal dna recognition domain of the bacillus subtilis transition-state regulator abrb
PDB DOI: 10.2210/pdb2ro4/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Subtilis
Deposited: 2008-03-08 Deposition Author(s): Bobay, B.G. , Cavanagh, J. , Kojetin, D.J. , Rance, M. , Strauch, M.A. , Sullivan, D.M. , Thompson, R.J.
Method: SOLUTION NMR Resolution: N.A.
Rdc-refined solution structure of the n-terminal dna recognition domain of the bacillus subtilis transition-state regulator abrb
Bobay, B.G. , Cavanagh, J. , Kojetin, D.J. , Rance, M. , Strauch, M.A. , Sullivan, D.M. , Thompson, R.J.
Primary Citation of Related Structures: 2RO4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transition state regulatory protein abrB | A | 53 | Bacillus Subtilis | MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT |
Transition state regulatory protein abrB | B | 53 | Bacillus Subtilis | MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT |
Method: SOLUTION NMR
Deposited Date: 2008-03-08 Deposition Author(s): Bobay, B.G. , Cavanagh, J. , Kojetin, D.J. , Rance, M. , Strauch, M.A. , Sullivan, D.M. , Thompson, R.J.