2RO3
Rdc-refined solution structure of the n-terminal dna recognition domain of the bacillus subtilis transition-state regulator abh
PDB DOI: 10.2210/pdb2ro3/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Subtilis
Deposited: 2008-03-08 Deposition Author(s): Bobay, B.G. , Cavanagh, J. , Douglas, K.J. , Rance, M. , Strauch, M.A. , Sullivan, D.M. , Thompson, R.J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Rdc-refined solution structure of the n-terminal dna recognition domain of the bacillus subtilis transition-state regulator abh
Bobay, B.G. , Cavanagh, J. , Douglas, K.J. , Rance, M. , Strauch, M.A. , Sullivan, D.M. , Thompson, R.J.
Primary Citation of Related Structures: 2RO3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative transition state regulator abh | A | 54 | Bacillus Subtilis | MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVC |
| Putative transition state regulator abh | B | 54 | Bacillus Subtilis | MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVC |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2008-03-08 Deposition Author(s): Bobay, B.G. , Cavanagh, J. , Douglas, K.J. , Rance, M. , Strauch, M.A. , Sullivan, D.M. , Thompson, R.J.