Solution structure of the c-terminal acidic domain of tfiie alpha
PDB DOI: 10.2210/pdb2rnq/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2008-01-31 Deposition Author(s): Nishimura, Y. , Okuda, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the c-terminal acidic domain of tfiie alpha
Primary Citation of Related Structures: 2RNQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription initiation factor IIE subunit alpha | A | 64 | Homo Sapiens | GSEEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE |
Method: SOLUTION NMR
Deposited Date: 2008-01-31 Deposition Author(s): Nishimura, Y. , Okuda, M.