Solution structure of the shp-1 c-terminal sh2 domain complexed with a tyrosine-phosphorylated peptide from nkg2a
PDB DOI: 10.2210/pdb2rmx/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-11-30 Deposition Author(s): Inoue, M. , Kasai, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the shp-1 c-terminal sh2 domain complexed with a tyrosine-phosphorylated peptide from nkg2a
Inoue, M. , Kasai, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 2RMX
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tyrosine-protein phosphatase non-receptor type 6 | A | 118 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSSGSSGWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYSGPSSG |
NKG2-A/NKG2-B type II integral membrane protein | B | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MDNQGVIYSDLNLPP |
Method: SOLUTION NMR
Deposited Date: 2007-11-30 Deposition Author(s): Inoue, M. , Kasai, T. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.