Three-dimensional structure of the two peptides that constitute the two-peptide bacteriocin plantaracin ef
PDB DOI: 10.2210/pdb2rlw/pdb
Classification: TOXIN Organism(s): Lactobacillus Plantarum
Deposited: 2007-08-27 Deposition Author(s): Fimland, G. , Fimland, N. , Kristiansen, P. , Nissen-Meyer, J. , Rogne, P.
Three-dimensional structure of the two peptides that constitute the two-peptide bacteriocin plantaracin ef
Fimland, G. , Fimland, N. , Kristiansen, P. , Nissen-Meyer, J. , Rogne, P.
Primary Citation of Related Structures: 2RLW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PlnF | A | 34 | Lactobacillus Plantarum | VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG |
Method: SOLUTION NMR
Deposited Date: 2007-08-27 Deposition Author(s): Fimland, G. , Fimland, N. , Kristiansen, P. , Nissen-Meyer, J. , Rogne, P.