Three-dimensional structure of the two peptides that constitute the two-peptide bacteriocin plantaracin ef
PDB DOI: 10.2210/pdb2rlw/pdb
Classification: TOXIN Organism(s): Pseudomonas Syringae Pv. Maculicola Str. Es4326
Deposited: 2007-08-27 Deposition Author(s): Fimland, G. , Fimland, N. , Kristiansen, P. , Nissen-Meyer, J. , Rogne, P.
Three-dimensional structure of the two peptides that constitute the two-peptide bacteriocin plantaracin ef
Fimland, G. , Fimland, N. , Kristiansen, P. , Nissen-Meyer, J. , Rogne, P.
Primary Citation of Related Structures: 2RLW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
PlnF | A | 34 | Pseudomonas Syringae Pv. Maculicola Str. Es4326 | VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG |
Method: SOLUTION NMR
Deposited Date: 2007-08-27 Deposition Author(s): Fimland, G. , Fimland, N. , Kristiansen, P. , Nissen-Meyer, J. , Rogne, P.