Nmr structure of ccp modules 2-3 of complement factor h
PDB DOI: 10.2210/pdb2rlq/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2007-07-29 Deposition Author(s): Barlow, P.N. , Herbert, A.P. , Hocking, H.G. , Kavanagh, D. , Pangburn, M.K. , Uhrin, D.
Nmr structure of ccp modules 2-3 of complement factor h
Barlow, P.N. , Herbert, A.P. , Hocking, H.G. , Kavanagh, D. , Pangburn, M.K. , Uhrin, D.
Primary Citation of Related Structures: 2RLQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Complement factor H | A | 129 | Homo Sapiens | EAEAAGPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCV |
Method: SOLUTION NMR
Deposited Date: 2007-07-29 Deposition Author(s): Barlow, P.N. , Herbert, A.P. , Hocking, H.G. , Kavanagh, D. , Pangburn, M.K. , Uhrin, D.