Crystal structure of pyruvate oxidoreductase subunit porc (ec 1.2.7.1) (tm0015) from thermotoga maritima at 2.12 a resolution
PDB DOI: 10.2210/pdb2raa/pdb
Classification: OXIDOREDUCTASE Organism(s): Thermotoga Maritima Msb8
Deposited: 2007-09-14 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of pyruvate oxidoreductase subunit porc (ec 1.2.7.1) (tm0015) from thermotoga maritima at 2.12 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 2RAA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pyruvate synthase subunit porC | A | 204 | Thermotoga Maritima Msb8 | MGSDKIHHHHHHMPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSE |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-09-14 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)