Crystal structure of a bowman-birk inhibitor from vigna unguiculata seeds
PDB DOI: 10.2210/pdb2r33/pdb
Classification: PLANT PROTEIN Organism(s): Vigna Unguiculata
Deposited: 2007-08-28 Deposition Author(s): Rao, K.N. , Suresh, C.G.
Crystal structure of a bowman-birk inhibitor from vigna unguiculata seeds
Primary Citation of Related Structures: 2R33
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bowman-Birk type seed trypsin and chymotrypsin inhibitor | A | 74 | Vigna Unguiculata | SGHHEDSTDEPSESSEPCCDSCVCTKSIPPQCHCTNIRLNSCHSGCKSCLCTFSIPGSCRCLDIANFCYKPCKS |
| Bowman-Birk type seed trypsin and chymotrypsin inhibitor | B | 74 | Vigna Unguiculata | SGHHEDSTDEPSESSEPCCDSCVCTKSIPPQCHCTNIRLNSCHSGCKSCLCTFSIPGSCRCLDIANFCYKPCKS |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-08-28 Deposition Author(s): Rao, K.N. , Suresh, C.G.