Crystal structure of a duf416 family protein (sbal_3149) from shewanella baltica os155 at 1.91 a resolution
PDB DOI: 10.2210/pdb2q9r/pdb
Classification: UNKNOWN FUNCTION Organism(s): Shewanella Baltica
Deposited: 2007-06-13 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of a duf416 family protein (sbal_3149) from shewanella baltica os155 at 1.91 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 2Q9R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein of unknown function | A | 200 | Shewanella Baltica | GMTKKTGFFKRLKALTLPQKQLFATALCQRMLPNYQLFSEVCEFGDPAVLSTALELLWQSLYDPKLKFNIDVHLQRLEDNTPEPADFEAYGVYPAMDAVVAISTLLGAIQGKIEEDIVNISKLSSSTVANYIEAISDVDLVDEALDDFVFAHEVMEEEKELQNSLLEIIEENPKITAELVKGLRKDIIETGVSNIGISVA |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-06-13 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)