Variant 1 of ribonucleoprotein core of the e. coli signal recognition particle
PDB DOI: 10.2210/pdb2pxd/pdb
Classification: SIGNALING PROTEIN/RNA Organism(s): Escherichia Coli , Synthetic Construct
Deposited: 2007-05-14 Deposition Author(s): Batey, R.T. , Keel, A.Y. , Kieft, J.S. , Rambo, R.P.
Variant 1 of ribonucleoprotein core of the e. coli signal recognition particle
Batey, R.T. , Keel, A.Y. , Kieft, J.S. , Rambo, R.P.
Primary Citation of Related Structures: 2PXD
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 4.5 S RNA | b | 49 | NA | GGGGCUGUUUACCAGGUCAGGUCCGAAAGGAAGCAGCCAAGGCAGUUCC |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Signal recognition particle protein | A | 102 | Escherichia Coli , Synthetic Construct | FDLNDFLEQLRQMKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKM |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-05-14 Deposition Author(s): Batey, R.T. , Keel, A.Y. , Kieft, J.S. , Rambo, R.P.