Crystal structure of the leucine zipper domain of small-conductance ca2+-activated k+ (skca) channel from rattus norvegicus
PDB DOI: 10.2210/pdb2pnv/pdb
Classification: MEMBRANE PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2007-04-25 Deposition Author(s): Eom, S.H. , Kang, G.B. , Kim, J.Y. , Kim, M.K. , Park, C.S.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of the leucine zipper domain of small-conductance ca2+-activated k+ (skca) channel from rattus norvegicus
Eom, S.H. , Kang, G.B. , Kim, J.Y. , Kim, M.K. , Park, C.S.
Primary Citation of Related Structures: 2PNV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Small conductance calcium-activated potassium channel protein 2 | A | 43 | Rattus Norvegicus | GSHMNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALP |
| Small conductance calcium-activated potassium channel protein 2 | B | 43 | Rattus Norvegicus | GSHMNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALP |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-04-25 Deposition Author(s): Eom, S.H. , Kang, G.B. , Kim, J.Y. , Kim, M.K. , Park, C.S.