Solution structure of rhodostomin p48a mutant
PDB DOI: 10.2210/pdb2pji/pdb
Classification: HYDROLASE Organism(s): Calloselasma Rhodostoma
Deposited: 2007-04-16 Deposition Author(s): Chuang, W.-J. , Liu, Y.-C. , Shiu, J.-H.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of rhodostomin p48a mutant
Chuang, W.-J. , Liu, Y.-C. , Shiu, J.-H.
Primary Citation of Related Structures: 2PJI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rhodostoxin-disintegrin rhodostomin | A | 68 | Calloselasma Rhodostoma | GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDMPDDRCTGQSADCPRYH |
Method: SOLUTION NMR
Deposited Date: 2007-04-16 Deposition Author(s): Chuang, W.-J. , Liu, Y.-C. , Shiu, J.-H.