Crystal structure of the complex formed between phospholipase a2 and peptide ala-val-tyr-ser at 2.0 a resolution
PDB DOI: 10.2210/pdb2pb8/pdb
Classification: HYDROLASE Organism(s): Tick-Borne Encephalitis Virus (Strain Sofjin) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2007-03-28 Deposition Author(s): Kaur, P. , Kumar, S. , Sharma, S. , Singh, N. , Singh, T.P.
Crystal structure of the complex formed between phospholipase a2 and peptide ala-val-tyr-ser at 2.0 a resolution
Kaur, P. , Kumar, S. , Sharma, S. , Singh, N. , Singh, T.P.
Primary Citation of Related Structures: 2PB8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Phospholipase A2 VRV-PL-VIIIa | A | 121 | Tick-Borne Encephalitis Virus (Strain Sofjin) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC |
AVYS | P | 4 | Tick-Borne Encephalitis Virus (Strain Sofjin) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AVYS |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-03-28 Deposition Author(s): Kaur, P. , Kumar, S. , Sharma, S. , Singh, N. , Singh, T.P.