Solution structure of a non-biological atp-binding protein
PDB DOI: 10.2210/pdb2p0x/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Gene
Deposited: 2007-03-01 Deposition Author(s): Chaput, J.C. , Mansy, S.S. , Szostak, J.W.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a non-biological atp-binding protein
Chaput, J.C. , Mansy, S.S. , Szostak, J.W.
Primary Citation of Related Structures: 2P0X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| abiotic ATP-binding, folding optimized protein | A | 64 | Synthetic Gene | GSFRVKPCVVCKVAPRDWRVKNRHLRIYNMCKTCFNNSIKSGDDTYHGHVDWLMYTDAKEFSST |
Method: SOLUTION NMR
Deposited Date: 2007-03-01 Deposition Author(s): Chaput, J.C. , Mansy, S.S. , Szostak, J.W.