The crystal structure of the 2nd pdz domain of the human nherf-1 (slc9a3r1)
PDB DOI: 10.2210/pdb2ozf/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2007-02-26 Deposition Author(s): Arrowsmith, C.H. , Berridge, G. , Bray, J. , Colebrook, S. , Doyle, D.A. , Edwards, A. , Elkins, J. , Fedorov, O. , Gileadi, C. , Gileadi, O. , Gorrec, F. , Papagrigoriou, E. , Phillips, C. , Salah, E. , Savitsky, P. , Schoch, G. , Smee, C. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Turnbull, A.P. , Umeano, C. , Uppenberg, J. , Von Delft, F. , Weigelt, J.
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
The crystal structure of the 2nd pdz domain of the human nherf-1 (slc9a3r1)
Arrowsmith, C.H. , Berridge, G. , Bray, J. , Colebrook, S. , Doyle, D.A. , Edwards, A. , Elkins, J. , Fedorov, O. , Gileadi, C. , Gileadi, O. , Gorrec, F. , Papagrigoriou, E. , Phillips, C. , Salah, E. , Savitsky, P. , Schoch, G. , Smee, C. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Turnbull, A.P. , Umeano, C. , Uppenberg, J. , Von Delft, F. , Weigelt, J.
Primary Citation of Related Structures: 2OZF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ezrin-radixin-moesin-binding phosphoprotein 50 | A | 92 | Homo Sapiens | SMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETETSL |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-02-26 Deposition Author(s): Arrowsmith, C.H. , Berridge, G. , Bray, J. , Colebrook, S. , Doyle, D.A. , Edwards, A. , Elkins, J. , Fedorov, O. , Gileadi, C. , Gileadi, O. , Gorrec, F. , Papagrigoriou, E. , Phillips, C. , Salah, E. , Savitsky, P. , Schoch, G. , Smee, C. , Structural Genomics Consortium (Sgc) , Sundstrom, M. , Turnbull, A.P. , Umeano, C. , Uppenberg, J. , Von Delft, F. , Weigelt, J.