Helix bundle quaternary structure from alpha/beta-peptide foldamers: gcn4-p1 with beta-residues at b and f heptad positions.
PDB DOI: 10.2210/pdb2oxj/pdb
Classification: UNKNOWN FUNCTION Organism(s): N.A.
Deposited: 2007-02-20 Deposition Author(s): Gellman, S.H. , Horne, W.S. , Keck, J.L. , Price, J.L.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Helix bundle quaternary structure from alpha/beta-peptide foldamers: gcn4-p1 with beta-residues at b and f heptad positions.
Gellman, S.H. , Horne, W.S. , Keck, J.L. , Price, J.L.
Primary Citation of Related Structures: 2OXJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids | A | 34 | N.A. | XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER |
hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids | B | 34 | N.A. | XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER |
hybrid alpha/beta peptide based on the GCN4-p1 sequence; heptad positions b and f substituted with beta-amino acids | C | 34 | N.A. | XRMKQLEDKVEELLSKNYHLENEVARLKKLVXER |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-02-20 Deposition Author(s): Gellman, S.H. , Horne, W.S. , Keck, J.L. , Price, J.L.