Crystal structure of a coiled-coil tetramerization domain from kv7.4 channels
PDB DOI: 10.2210/pdb2ovc/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 2007-02-13 Deposition Author(s): Clark, K.A. , Holton, J.M. , Howard, R.J. , Minor, D.L.
Method: X-RAY DIFFRACTION Resolution: 2.07 Å
Crystal structure of a coiled-coil tetramerization domain from kv7.4 channels
Clark, K.A. , Holton, J.M. , Howard, R.J. , Minor, D.L.
Primary Citation of Related Structures: 2OVC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium voltage-gated channel subfamily KQT member 4 | A | 33 | Homo Sapiens | GAVDEISMMGRVVKVEKQVQSIEHKLDLLLGFY |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-02-13 Deposition Author(s): Clark, K.A. , Holton, J.M. , Howard, R.J. , Minor, D.L.