Crystal structure of b. stearothermophilus tryptophanyl trna synthetase in complex with adenosine tetraphosphate
PDB DOI: 10.2210/pdb2ov4/pdb
Classification: LIGASE Organism(s): Geobacillus Stearothermophilus
Deposited: 2007-02-12 Deposition Author(s): Carter Jr., C.W. , Retailleau, P.
Crystal structure of b. stearothermophilus tryptophanyl trna synthetase in complex with adenosine tetraphosphate
Carter Jr., C.W. , Retailleau, P.
Primary Citation of Related Structures: 2OV4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tryptophanyl-tRNA synthetase | A | 328 | Geobacillus Stearothermophilus | MKTIFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHAITVWQDPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGKEAVSAGLLTYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADLAQVVIETLRPIQERYHHWMESEELDRVLDEGAEKANRVASEMVRKMEQAMGLGRRR |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-02-12 Deposition Author(s): Carter Jr., C.W. , Retailleau, P.