Recognition of a dna operator by the repressor of phage 434. a view at high resolution
PDB DOI: 10.2210/pdb2or1/pdb
Classification: GENE REGULATION/DNA Organism(s): Bacillus Cereus 95/8201 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1989-09-05 Deposition Author(s): Aggarwal, A.K. , Drottar, M. , Harrison, S.C. , Ptashne, M. , Rodgers, D.W.
Recognition of a dna operator by the repressor of phage 434. a view at high resolution
Aggarwal, A.K. , Drottar, M. , Harrison, S.C. , Ptashne, M. , Rodgers, D.W.
Primary Citation of Related Structures: 2OR1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
434 REPRESSOR | L | 69 | Bacillus Cereus 95/8201 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGTSDSNVR |
434 REPRESSOR | R | 69 | Bacillus Cereus 95/8201 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGTSDSNVR |
Method: X-RAY DIFFRACTION
Deposited Date: 1989-09-05 Deposition Author(s): Aggarwal, A.K. , Drottar, M. , Harrison, S.C. , Ptashne, M. , Rodgers, D.W.