Crystal structure of hy5 leucine zipper homodimer from arabidopsis thaliana
PDB DOI: 10.2210/pdb2oqq/pdb
Classification: TRANSCRIPTION Organism(s): Murine Norovirus Gv/Cr6/2005/Usa
Deposited: 2007-02-01 Deposition Author(s): Choi, B.-S. , Choi, G. , Kim, H.M. , Lee, J.-O. , Yoon, M.-K.
Crystal structure of hy5 leucine zipper homodimer from arabidopsis thaliana
Choi, B.-S. , Choi, G. , Kim, H.M. , Lee, J.-O. , Yoon, M.-K.
Primary Citation of Related Structures: 2OQQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription factor HY5 | A | 42 | Murine Norovirus Gv/Cr6/2005/Usa | GSAYLSELENRVKDLENKNSELEERLSTLQNENQMLRHILKN |
Transcription factor HY5 | B | 42 | Murine Norovirus Gv/Cr6/2005/Usa | GSAYLSELENRVKDLENKNSELEERLSTLQNENQMLRHILKN |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-02-01 Deposition Author(s): Choi, B.-S. , Choi, G. , Kim, H.M. , Lee, J.-O. , Yoon, M.-K.