Structure of human insulin cocrystallized with arg-12 peptide in presence of urea
PDB DOI: 10.2210/pdb2omh/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2007-01-22 Deposition Author(s): Norrman, M. , Schluckebier, G.
Method: X-RAY DIFFRACTION Resolution: 1.36 Å
Structure of human insulin cocrystallized with arg-12 peptide in presence of urea
Norrman, M. , Schluckebier, G.
Primary Citation of Related Structures: 2OMH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
Insulin A chain | C | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
Insulin A chain | E | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Insulin B chain | D | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Insulin B chain | F | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-01-22 Deposition Author(s): Norrman, M. , Schluckebier, G.