Crystal structure of the complex formed between a group ii phospholipase a2 and an indole derivative at 2.2 a resolution
PDB DOI: 10.2210/pdb2oli/pdb
Classification: HYDROLASE Organism(s): Daboia Russellii Pulchella
Deposited: 2007-01-19 Deposition Author(s): Kaur, P. , Kumar, S. , Sharma, S. , Singh, N. , Singh, T.P.
Crystal structure of the complex formed between a group ii phospholipase a2 and an indole derivative at 2.2 a resolution
Kaur, P. , Kumar, S. , Sharma, S. , Singh, N. , Singh, T.P.
Primary Citation of Related Structures: 2OLI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phospholipase A2 VRV-PL-VIIIa | A | 121 | Daboia Russellii Pulchella | SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC |
Method: X-RAY DIFFRACTION
Deposited Date: 2007-01-19 Deposition Author(s): Kaur, P. , Kumar, S. , Sharma, S. , Singh, N. , Singh, T.P.