2OEI
Crystal structure of human fe65-ww domain in complex with human mena peptide
PDB DOI: 10.2210/pdb2oei/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2006-12-29 Deposition Author(s): Birrane, G. , Ladias, J.A.A. , Meiyappan, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.35 Å
Crystal structure of human fe65-ww domain in complex with human mena peptide
Birrane, G. , Ladias, J.A.A. , Meiyappan, M.
Primary Citation of Related Structures: 2OEI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Amyloid beta A4 protein-binding family B member 1 | A | 38 | Homo Sapiens , Synthetic Construct | GSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPS |
| poly-proline peptide | B | 9 | Homo Sapiens , Synthetic Construct | PPPPPPLPP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-12-29 Deposition Author(s): Birrane, G. , Ladias, J.A.A. , Meiyappan, M.