2OEI
Crystal structure of human fe65-ww domain in complex with human mena peptide
PDB DOI: 10.2210/pdb2oei/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-12-29 Deposition Author(s): Birrane, G. , Ladias, J.A.A. , Meiyappan, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.35 Å
Crystal structure of human fe65-ww domain in complex with human mena peptide
Birrane, G. , Ladias, J.A.A. , Meiyappan, M.
Primary Citation of Related Structures: 2OEI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Amyloid beta A4 protein-binding family B member 1 | A | 38 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPS |
| poly-proline peptide | B | 9 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PPPPPPLPP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-12-29 Deposition Author(s): Birrane, G. , Ladias, J.A.A. , Meiyappan, M.