Solution structure of gip in tfe/water
PDB DOI: 10.2210/pdb2obu/pdb
Classification: HORMONE/GROWTH FACTOR Organism(s): N.A.
Deposited: 2006-12-20 Deposition Author(s): Alana, I. , Hewage, C.M. , Malthouse, J.P.G. , O'Harte, F.P.M.
Solution structure of gip in tfe/water
Alana, I. , Hewage, C.M. , Malthouse, J.P.G. , O'Harte, F.P.M.
Primary Citation of Related Structures: 2OBU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gastric inhibitory polypeptide | A | 42 | N.A. | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Method: SOLUTION NMR
Deposited Date: 2006-12-20 Deposition Author(s): Alana, I. , Hewage, C.M. , Malthouse, J.P.G. , O'Harte, F.P.M.