Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein nsp4
PDB DOI: 10.2210/pdb2o1k/pdb
Classification: VIRAL PROTEIN Organism(s): Simian Rotavirus A/Sa11
Deposited: 2006-11-29 Deposition Author(s): Deepa, R. , Durga Rao, C. , Suguna, K.
Method: X-RAY DIFFRACTION Resolution: 1.67 Å
Structure of the extended diarrhea-inducing domain of rotavirus enterotoxigenic protein nsp4
Deepa, R. , Durga Rao, C. , Suguna, K.
Primary Citation of Related Structures: 2O1K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Non-structural glycoprotein NSP4 | A | 52 | Simian Rotavirus A/Sa11 | IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTK |
| Non-structural glycoprotein NSP4 | B | 52 | Simian Rotavirus A/Sa11 | IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTK |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-11-29 Deposition Author(s): Deepa, R. , Durga Rao, C. , Suguna, K.