Solution structure of the first sh3 domain of human vinexin and its interaction with the peptides from vinculin
PDB DOI: 10.2210/pdb2nwm/pdb
Classification: CELL ADHESION Organism(s): Homo Sapiens
Deposited: 2006-11-15 Deposition Author(s): Shi, Y. , Wu, J. , Yao, B. , Zhang, J.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Vinexin | A | 65 | Homo Sapiens | MKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWLEGEHHGRLGIFPANYVEVLPLEHHHHHH |
Method: SOLUTION NMR