1.15 angstrom crystal structure of the ma3 domain of pdcd4
PDB DOI: 10.2210/pdb2nsz/pdb
Classification: ANTITUMOR PROTEIN Organism(s): Mus Musculus
Deposited: 2006-11-06 Deposition Author(s): Laronde-Leblanc, N. , Wlodawer, A.
1.15 angstrom crystal structure of the ma3 domain of pdcd4
Laronde-Leblanc, N. , Wlodawer, A.
Primary Citation of Related Structures: 2NSZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Programmed cell death protein 4 | A | 129 | Mus Musculus | QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-11-06 Deposition Author(s): Laronde-Leblanc, N. , Wlodawer, A.