Structures of and interactions between domains of trigger factor from themotoga maritima
PDB DOI: 10.2210/pdb2nsc/pdb
Classification: CHAPERONE Organism(s): Thermotoga Maritima
Deposited: 2006-11-03 Deposition Author(s): Hendrickson, W.A. , Martinez-Hackert, E.
Structures of and interactions between domains of trigger factor from themotoga maritima
Hendrickson, W.A. , Martinez-Hackert, E.
Primary Citation of Related Structures: 2NSC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Trigger factor | A | 109 | Thermotoga Maritima | MEVKELERDKNRVVLEYVFGAEEIAQAEDKAVRYLNQRVEIPGFRKGRIPKNVLKMKLGEEFQEYTLDFLMDLIPDTLKDRKLILSPIVTERELKDVTARVVVEVHEEP |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-11-03 Deposition Author(s): Hendrickson, W.A. , Martinez-Hackert, E.