2NPH
Crystal structure of hiv1 protease in situ product complex
PDB DOI: 10.2210/pdb2nph/pdb
Classification: HYDROLASE Organism(s): Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2006-10-27 Deposition Author(s): Das, A. , Hosur, M.V. , Prashar, V.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.65 Å
Crystal structure of hiv1 protease in situ product complex
Das, A. , Hosur, M.V. , Prashar, V.
Primary Citation of Related Structures: 2NPH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEASE RETROPEPSIN | A | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGMTLNF |
| PROTEASE RETROPEPSIN | B | 99 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGMTLNF |
| tetrapeptide fragment | S | 4 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AETF |
| pentapeptide fragment | T | 5 | Anoxybacillus Sp. Lm18-11 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | YVDGA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2006-10-27 Deposition Author(s): Das, A. , Hosur, M.V. , Prashar, V.