Simultaneous determination of protein structure and dynamics using rdcs
PDB DOI: 10.2210/pdb2nmq/pdb
Classification: SIGNALING PROTEIN Organism(s): Streptococcus Sp. 'Group G'
Deposited: 2006-10-23 Deposition Author(s): Blackledge, M. , Bouvignies, G. , Brueschweiler, R. , Markwick, P.
Method: SOLUTION NMR Resolution: N.A.
Simultaneous determination of protein structure and dynamics using rdcs
Blackledge, M. , Bouvignies, G. , Brueschweiler, R. , Markwick, P.
Primary Citation of Related Structures: 2NMQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein G precursor | A | 55 | Streptococcus Sp. 'Group G' | TYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE |
Method: SOLUTION NMR
Deposited Date: 2006-10-23 Deposition Author(s): Blackledge, M. , Bouvignies, G. , Brueschweiler, R. , Markwick, P.