Solution structure of the de novo mini protein geeh_04
PDB DOI: 10.2210/pdb2nd3/pdb
Classification: DE NOVO PROTEIN Organism(s): Artificial Gene
Deposited: 2016-04-22 Deposition Author(s): Bahl, C.D. , Baker, D. , Buchko, G.W. , Eletsky, A. , Gilmore, J.M. , Pulavarti, S.V. , Szyperski, T.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the de novo mini protein geeh_04
Bahl, C.D. , Baker, D. , Buchko, G.W. , Eletsky, A. , Gilmore, J.M. , Pulavarti, S.V. , Szyperski, T.
Primary Citation of Related Structures: 2ND3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| De novo mini protein EEH_04 | A | 38 | Artificial Gene | QCYTFRSECTNKEFTVCRPNPEEVEKEARRTKEEECRK |
Method: SOLUTION NMR
Deposited Date: 2016-04-22 Deposition Author(s): Bahl, C.D. , Baker, D. , Buchko, G.W. , Eletsky, A. , Gilmore, J.M. , Pulavarti, S.V. , Szyperski, T.