Solution structure of zitp zinc finger
PDB DOI: 10.2210/pdb2nb9/pdb
Classification: UNKNOWN FUNCTION Organism(s): Caulobacter Crescentus
Deposited: 2016-02-01 Deposition Author(s): Allain, F.H.-T. , Berge, M. , Campagne, S. , Viollier, P.H.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of zitp zinc finger
Allain, F.H.-T. , Berge, M. , Campagne, S. , Viollier, P.H.
Primary Citation of Related Structures: 2NB9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein | A | 49 | Caulobacter Crescentus | MILTCPECASRYFVDDSKVGPDGRVVRCASCGNRWTAFKDEAELELVPR |
Method: SOLUTION NMR
Deposited Date: 2016-02-01 Deposition Author(s): Allain, F.H.-T. , Berge, M. , Campagne, S. , Viollier, P.H.