Nmr solution structure of exendin-4/conotoxin chimera (ex-4[1-27]/pl14a)
PDB DOI: 10.2210/pdb2naw/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2016-01-12 Deposition Author(s): Craik, D.J. , Schroeder, C.I. , Swedberg, J.E.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of exendin-4/conotoxin chimera (ex-4[1-27]/pl14a)
Craik, D.J. , Schroeder, C.I. , Swedberg, J.E.
Primary Citation of Related Structures: 2NAW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Exendin-4, Alpha/kappa-conotoxin pl14a chimera | A | 39 | N.A. | HGEGTFTSDLSKQMEEEAVRCFIECLKGIGHKYPFCHCR |
Method: SOLUTION NMR
Deposited Date: 2016-01-12 Deposition Author(s): Craik, D.J. , Schroeder, C.I. , Swedberg, J.E.