Transmembrane structure of the p441a mutant of the cytokine receptor common subunit beta
PDB DOI: 10.2210/pdb2na9/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2015-12-21 Deposition Author(s): An, W. , Ginsberg, M.H. , Schmidt, T. , Situ, A.J. , Ulmer, T.S. , Ye, F.
Transmembrane structure of the p441a mutant of the cytokine receptor common subunit beta
An, W. , Ginsberg, M.H. , Schmidt, T. , Situ, A.J. , Ulmer, T.S. , Ye, F.
Primary Citation of Related Structures: 2NA9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cytokine receptor common subunit beta | A | 44 | Salmonella Enterica | GKRSWDTESVLAMWVLALIVIFLTIAVLLALRFCGIYGYRLRRK |
Method: SOLUTION NMR
Deposited Date: 2015-12-21 Deposition Author(s): An, W. , Ginsberg, M.H. , Schmidt, T. , Situ, A.J. , Ulmer, T.S. , Ye, F.