Nmr structure of guanylyl cyclase activator protein 1 (gcap1) mutant v77e in a ca2+-free/mg2+-bound activator state
PDB DOI: 10.2210/pdb2na0/pdb
Classification: Lyase Activator Organism(s): Bos Taurus
Deposited: 2015-12-16 Deposition Author(s): Ames, J.B. , Lim, S.
Nmr structure of guanylyl cyclase activator protein 1 (gcap1) mutant v77e in a ca2+-free/mg2+-bound activator state
Primary Citation of Related Structures: 2NA0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Guanylyl cyclase-activating protein 1 | A | 205 | Bos Taurus | XGNIMDGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPWASQYVEQMFETFDFNKDGYIDFMEYEAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAIRAINPCSDSTMTAEEFTDTVFSKIDVNGDGELSLEEFMEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGASGRETEAAEADG |
Method: SOLUTION NMR
Deposited Date: 2015-12-16 Deposition Author(s): Ames, J.B. , Lim, S.