2N8T
Solution structure of the rnedd4 ww2 domain-cx43ct peptide complex by nmr
PDB DOI: 10.2210/pdb2n8t/pdb
Classification: LIGASE/peptide Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2015-10-27 Deposition Author(s): Kieken, F. , Sorgen, P.L. , Spagnol, G.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the rnedd4 ww2 domain-cx43ct peptide complex by nmr
Kieken, F. , Sorgen, P.L. , Spagnol, G.
Primary Citation of Related Structures: 2N8T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4 | A | 39 | Rattus Norvegicus , Synthetic Construct | GSSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQD |
| Cx43CT Peptide | B | 14 | Rattus Norvegicus , Synthetic Construct | APLSPMSPPGYKLV |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2015-10-27 Deposition Author(s): Kieken, F. , Sorgen, P.L. , Spagnol, G.