PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

2N8T

Solution structure of the rnedd4 ww2 domain-cx43ct peptide complex by nmr

PDB DOI: 10.2210/pdb2n8t/pdb

Classification: LIGASE/peptide
Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2015-10-27
Deposition Author(s): Kieken, F. , Sorgen, P.L. , Spagnol, G.

Experimental Data Snapshot

Method: SOLUTION NMR
Resolution: N.A.

Literature

Solution structure of the rnedd4 ww2 domain-cx43ct peptide complex by nmr

Kieken, F. , Sorgen, P.L. , Spagnol, G.

Primary Citation of Related Structures: 2N8T


Proteins
Molecule Chains Sequence Length Organism Sequence
E3 ubiquitin-protein ligase NEDD4 A 39 Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQD
Cx43CT Peptide B 14 Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) APLSPMSPPGYKLV
Experimental Data

Method: SOLUTION NMR

Deposited Date: 2015-10-27
Deposition Author(s): Kieken, F. , Sorgen, P.L. , Spagnol, G.