Sidechain chi1 distribution in b3 domain of protein g from extensive sets of residual dipolar couplings
PDB DOI: 10.2210/pdb2n7j/pdb
Classification: SIGNALING PROTEIN Organism(s): Streptococcus Sp. 'Group G'
Deposited: 2015-09-12 Deposition Author(s): Bax, A. , Grishaev, A. , Li, F. , Ying, J.
Method: SOLUTION NMR Resolution: N.A.
Sidechain chi1 distribution in b3 domain of protein g from extensive sets of residual dipolar couplings
Bax, A. , Grishaev, A. , Li, F. , Ying, J.
Primary Citation of Related Structures: 2N7J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein G | A | 56 | Streptococcus Sp. 'Group G' | MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE |
Method: SOLUTION NMR
Deposited Date: 2015-09-12 Deposition Author(s): Bax, A. , Grishaev, A. , Li, F. , Ying, J.