Solution nmr structure of outer membrane protein g from pseudomonas aeruginosa
PDB DOI: 10.2210/pdb2n6l/pdb
Classification: MEMBRANE PROTEIN Organism(s): Pseudomonas Aeruginosa
Deposited: 2015-08-25 Deposition Author(s): Edrington, T.C. , Kucharska, I. , Liang, B. , Seelheim, P. , Tamm, L.K.
Solution nmr structure of outer membrane protein g from pseudomonas aeruginosa
Edrington, T.C. , Kucharska, I. , Liang, B. , Seelheim, P. , Tamm, L.K.
Primary Citation of Related Structures: 2N6L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Outer membrane protein OprG | A | 215 | Pseudomonas Aeruginosa | MHKAGDFIIRGGFATVDPDDSSSDIKLDGAKQRGTKATVDSDTQLGLTFTYMFADKWGVELVAATPFNHQVDVKGLGPGLDGKLADIKQLPPTLLLQYYPMGGTNSAFQPYGGLGVNYTTFFDEDLASNRKAQGFSSMKLQDSWGLAGELGFDYMLNEHALFNMAVWYMDIDTKASINGPSALGVNKTKVDVDVDPWVYMIGFGYKFLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2015-08-25 Deposition Author(s): Edrington, T.C. , Kucharska, I. , Liang, B. , Seelheim, P. , Tamm, L.K.